CNTF (Human) Recombinant Protein
  • CNTF (Human) Recombinant Protein

CNTF (Human) Recombinant Protein

Ref: AB-P7122
CNTF (Human) Recombinant Protein

Información del producto

Human CNTF (P26441-1, 1 a.a. - 200 a.a.) full-length recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name CNTF
Gene Alias HCNTF
Gene Description ciliary neurotrophic factor
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTV RSIHDLRFISSHQTGIPARGSHYIANNKKM
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 1270

Enviar un mensaje


CNTF (Human) Recombinant Protein

CNTF (Human) Recombinant Protein