CNTF (Human) Recombinant Protein View larger

Human CNTF (P26441-1, 1 a.a. - 200 a.a.) full-length recombinant protein expressed in HEK293 cells.

AB-P7122

New product

CNTF (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name CNTF
Gene Alias HCNTF
Gene Description ciliary neurotrophic factor
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTV RSIHDLRFISSHQTGIPARGSHYIANNKKM
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL.
Gene ID 1270

More info

Human CNTF (P26441-1, 1 a.a. - 200 a.a.) full-length recombinant protein expressed in HEK293 cells.

Enviar uma mensagem

Human CNTF (P26441-1, 1 a.a. - 200 a.a.) full-length recombinant protein expressed in HEK293 cells.

Human CNTF (P26441-1, 1 a.a. - 200 a.a.) full-length recombinant protein expressed in HEK293 cells.