Ver mas grande
Egf (Rat) Recombinant Protein
AB-P7100
Producto nuevo
Egf (Rat) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Egf |
| Gene Alias | - |
| Gene Description | epidermal growth factor |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWK |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS up to 100 ug/ml |
| Gene ID | 25313 |
Más información
Rat Egf (P07522, 974 a.a - 1026 a.a.) partial recombinant protein expressed in CHO cell.