Egf (Rat) Recombinant Protein View larger

Rat Egf (P07522, 974 a.a - 1026 a.a.) partial recombinant protein expressed in CHO cell.

AB-P7100

New product

Egf (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name Egf
Gene Alias -
Gene Description epidermal growth factor
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWK
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 25313

More info

Rat Egf (P07522, 974 a.a - 1026 a.a.) partial recombinant protein expressed in CHO cell.

Enviar uma mensagem

Rat Egf (P07522, 974 a.a - 1026 a.a.) partial recombinant protein expressed in CHO cell.

Rat Egf (P07522, 974 a.a - 1026 a.a.) partial recombinant protein expressed in CHO cell.