Ver mas grande
S (SARS-CoV-2) RBD Recombinant Protein
AB-P6675
Producto nuevo
S (SARS-CoV-2) RBD Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | DGSMRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKHHHHHH |
| Form | Liquid |
| Recomended Dilution | Bioactivity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | SARS-CoV-2 |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol). |
Más información
SARS-CoV-2 S RBD (QHD43416.1, 319 a.a. - 529 a.a.) recombinant protein with His tag at C-terminal expressed in HEK293 cells.