AB-P6675
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Size | 100 ug |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | DGSMRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKHHHHHH |
Form | Liquid |
Recomended Dilution | Bioactivity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | SARS-CoV-2 |
Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
Storage Buffer | In PBS, pH 7.4 (10% glycerol). |