Información del producto
HCoV-229E N (P15130, 1 a.a.- 389 a.a.) full-length recombinant protein with His tag at C-terminal expressed in Escherichia coli.
Información adicional
Size
100 ug
Storage Conditions
Store at -20C on dry atmosphere.
Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20C or -80C.
Aliquot to avoid repe
Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20C or -80C.
Aliquot to avoid repe
Application Key
SDS-PAGE
Immunogen Prot. Seq
MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPND
Form
Lyophilized
Recomended Dilution
SDS-PAGE
The optimal working dilution should be determined by the end user.
The optimal working dilution should be determined by the end user.
Antigen species Target species
Viruses
Quality control testing
SDS-PAGE Stained with Coomassie Blue
Storage Buffer
Lyophilized from PBS, pH 7.4.