N (HCoV-229E) Recombinant Protein
  • N (HCoV-229E) Recombinant Protein

N (HCoV-229E) Recombinant Protein

Ref: AB-P6655
N (HCoV-229E) Recombinant Protein

Información del producto

HCoV-229E N (P15130, 1 a.a.- 389 a.a.) full-length recombinant protein with His tag at C-terminal expressed in Escherichia coli.
Información adicional
Size 100 ug
Storage Conditions Store at -20C on dry atmosphere.
Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20C or -80C.
Aliquot to avoid repe
Application Key SDS-PAGE
Immunogen Prot. Seq MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPND
Form Lyophilized
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Viruses
Quality control testing SDS-PAGE Stained with Coomassie Blue
Storage Buffer Lyophilized from PBS, pH 7.4.

Enviar uma mensagem


N (HCoV-229E) Recombinant Protein

N (HCoV-229E) Recombinant Protein