S1 (SARS-CoV-2) Recombinant Protein
  • S1 (SARS-CoV-2) Recombinant Protein

S1 (SARS-CoV-2) Recombinant Protein

Ref: AB-P6651
S1 (SARS-CoV-2) Recombinant Protein

Información del producto

SARS-CoV-2 S1 (QHD43416.1, 16 a.a.- 671 a.a.) partial recombinant protein with His tag at C-terminal expressed in Escherichia coli.
Información adicional
Size 100 ug
Storage Conditions Store at -20C on dry atmosphere.
Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20C or -80C.
Aliquot to avoid repe
Application Key SDS-PAGE
Immunogen Prot. Seq MVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY
Form Lyophilized
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species SARS-CoV-2
Quality control testing SDS-PAGE Stained with Coomassie Blue
Storage Buffer Lyophilized from PBS, pH 7.4.

Enviar un mensaje


S1 (SARS-CoV-2) Recombinant Protein

S1 (SARS-CoV-2) Recombinant Protein