Información del producto
SARS-CoV-2 S1 (QHD43416.1, 16 a.a.- 671 a.a.) partial recombinant protein with His tag at C-terminal expressed in Escherichia coli.
Información adicional
Size
100 ug
Storage Conditions
Store at -20C on dry atmosphere.
Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20C or -80C.
Aliquot to avoid repe
Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20C or -80C.
Aliquot to avoid repe
Application Key
SDS-PAGE
Immunogen Prot. Seq
MVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY
Form
Lyophilized
Recomended Dilution
SDS-PAGE
The optimal working dilution should be determined by the end user.
The optimal working dilution should be determined by the end user.
Antigen species Target species
SARS-CoV-2
Quality control testing
SDS-PAGE Stained with Coomassie Blue
Storage Buffer
Lyophilized from PBS, pH 7.4.