S1 (SARS-CoV-2) Recombinant Protein View larger

SARS-CoV-2 S1 (QHD43416.1, 16 a.a.- 671 a.a.) partial recombinant protein with His tag at C-terminal expressed in <i>Escherichia

AB-P6651

New product

S1 (SARS-CoV-2) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100 ug
Storage Conditions Store at -20ºC on dry atmosphere.<br>Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20ºC or -80ºC.<br>Aliquot to avoid r
Application Key SDS-PAGE
Immunogen Prot. Seq MVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY
Form Lyophilized
Recomended Dilution SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species SARS-CoV-2
Quality control testing SDS-PAGE Stained with Coomassie Blue
Storage Buffer Lyophilized from PBS, pH 7.4.

More info

SARS-CoV-2 S1 (QHD43416.1, 16 a.a.- 671 a.a.) partial recombinant protein with His tag at C-terminal expressed in Escherichia coli.

Enviar uma mensagem

SARS-CoV-2 S1 (QHD43416.1, 16 a.a.- 671 a.a.) partial recombinant protein with His tag at C-terminal expressed in <i>Escherichia

SARS-CoV-2 S1 (QHD43416.1, 16 a.a.- 671 a.a.) partial recombinant protein with His tag at C-terminal expressed in <i>Escherichia