Ver mas grande
S (Bovine coronavirus) Recombinant Protein
AB-P6612
Producto nuevo
S (Bovine coronavirus) Recombinant Protein
Comprando este producto generará 28 Biopuntos. Su cesta contiene un total 28 Biopuntos puede ser convertido en un Biobonos Descuento 112.00EUR.
Hoja técnica
| Size | 1 mg |
| Storage Conditions | Store at -20ºC or lower, liquid antibodies are stable at least 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE |
| Antigen species Target species | Viruses |
| Storage Buffer | In Tris-based buffer (50% glycerol). |
Más información
Bovine coronavirus S (P15777, 326 a.a. - 540 a.a.) partial recombinant protein with N-terminal 10xHis tag expressed in Escherichia coli.