View larger
Bovine coronavirus S (P15777, 326 a.a. - 540 a.a.) partial recombinant protein with N-terminal 10xHis tag expressed in <i>Escher
AB-P6612
New product
S (Bovine coronavirus) Recombinant Protein
Ao comprar este produto pode ganhar até 28 pontos de fidelização. Seu carrinho totalizará 28 pontos de fidelização que podem ser convertidos num vale de desconto de 112.00EUR.
Data sheet
| Size | 1 mg |
| Storage Conditions | Store at -20ºC or lower, liquid antibodies are stable at least 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE |
| Antigen species Target species | Viruses |
| Storage Buffer | In Tris-based buffer (50% glycerol). |
More info
Bovine coronavirus S (P15777, 326 a.a. - 540 a.a.) partial recombinant protein with N-terminal 10xHis tag expressed in Escherichia coli.