S (Bovine coronavirus) Recombinant Protein
  • S (Bovine coronavirus) Recombinant Protein

S (Bovine coronavirus) Recombinant Protein

Ref: AB-P6612
S (Bovine coronavirus) Recombinant Protein

Información del producto

Bovine coronavirus S (P15777, 326 a.a. - 540 a.a.) partial recombinant protein with N-terminal 10xHis tag expressed in Escherichia coli.
Información adicional
Size 1 mg
Storage Conditions Store at -20C or lower, liquid antibodies are stable at least 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT
Form Liquid
Recomended Dilution SDS-PAGE
Antigen species Target species Viruses
Storage Buffer In Tris-based buffer (50% glycerol).

Enviar uma mensagem


S (Bovine coronavirus) Recombinant Protein

S (Bovine coronavirus) Recombinant Protein