WISP1 (Human) Recombinant Protein
  • WISP1 (Human) Recombinant Protein

WISP1 (Human) Recombinant Protein

Ref: AB-P6432
WISP1 (Human) Recombinant Protein

Información del producto

Human WISP1 (O95388) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name WISP1
Gene Alias CCN4|WISP1c|WISP1i|WISP1tc
Gene Description WNT1 inducible signaling pathway protein 1
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVY
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 8840

Enviar un mensaje


WISP1 (Human) Recombinant Protein

WISP1 (Human) Recombinant Protein