WISP1 (Human) Recombinant Protein View larger

Human WISP1 (O95388) recombinant protein expressed in <i>E. Coli</i>.

AB-P6432

New product

WISP1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name WISP1
Gene Alias CCN4|WISP1c|WISP1i|WISP1tc
Gene Description WNT1 inducible signaling pathway protein 1
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVY
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 8840

More info

Human WISP1 (O95388) recombinant protein expressed in E. Coli.

Enviar uma mensagem

Human WISP1 (O95388) recombinant protein expressed in <i>E. Coli</i>.

Human WISP1 (O95388) recombinant protein expressed in <i>E. Coli</i>.