NAMPT (Human) Recombinant Protein
  • NAMPT (Human) Recombinant Protein

NAMPT (Human) Recombinant Protein

Ref: AB-P6430
NAMPT (Human) Recombinant Protein

Información del producto

Human NAMPT (P43490) recombinant protein expressed in E. Coli.
Información adicional
Size 25 ug
Gene Name NAMPT
Gene Alias 1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN
Gene Description nicotinamide phosphoribosyltransferase
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFF
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 10135

Enviar un mensaje


NAMPT (Human) Recombinant Protein

NAMPT (Human) Recombinant Protein