NAMPT (Human) Recombinant Protein View larger

Human NAMPT (P43490) recombinant protein expressed in <i>E. Coli</i>.

AB-P6430

New product

NAMPT (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 25 ug
Gene Name NAMPT
Gene Alias 1110035O14Rik|DKFZp666B131|MGC117256|PBEF|PBEF1|VF|VISFATIN
Gene Description nicotinamide phosphoribosyltransferase
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFF
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 10135

More info

Human NAMPT (P43490) recombinant protein expressed in E. Coli.

Enviar uma mensagem

Human NAMPT (P43490) recombinant protein expressed in <i>E. Coli</i>.

Human NAMPT (P43490) recombinant protein expressed in <i>E. Coli</i>.