AB-P6407
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 20 ug |
Gene Name | FAM19A2 |
Gene Alias | DKFZp761E1217|DKFZp781P0552|MGC42403|TAFA-2|TAFA2 |
Gene Description | family with sequence similarity 19 (chemokine (C-C motif)-like), member A2 |
Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB |
Immunogen Prot. Seq | ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH |
Form | Lyophilized |
Storage Buffer | Lyophilized from PBS, pH 7.2. |
Gene ID | 338811 |