FAM19A2 (Human) Recombinant Protein
  • FAM19A2 (Human) Recombinant Protein

FAM19A2 (Human) Recombinant Protein

Ref: AB-P6407
FAM19A2 (Human) Recombinant Protein

Información del producto

Human FAM19A2 (Q8N3H0) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name FAM19A2
Gene Alias DKFZp761E1217|DKFZp781P0552|MGC42403|TAFA-2|TAFA2
Gene Description family with sequence similarity 19 (chemokine (C-C motif)-like), member A2
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 338811

Enviar un mensaje


FAM19A2 (Human) Recombinant Protein

FAM19A2 (Human) Recombinant Protein