View larger
Human FAM19A2 (Q8N3H0) recombinant protein expressed in <i>E. Coli</i>.
AB-P6407
New product
FAM19A2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | FAM19A2 |
| Gene Alias | DKFZp761E1217|DKFZp781P0552|MGC42403|TAFA-2|TAFA2 |
| Gene Description | family with sequence similarity 19 (chemokine (C-C motif)-like), member A2 |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB |
| Immunogen Prot. Seq | ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 338811 |
More info
Human FAM19A2 (Q8N3H0) recombinant protein expressed in E. Coli.