ROR1 (Human) Recombinant Protein
  • ROR1 (Human) Recombinant Protein

ROR1 (Human) Recombinant Protein

Ref: AB-P6400
ROR1 (Human) Recombinant Protein

Información del producto

Human ROR1 (Q01973) recombinant protein expressed in CHO cells.
Información adicional
Size 100 ug
Gene Name ROR1
Gene Alias MGC99659|NTRKR1|dJ537F10.1
Gene Description receptor tyrosine kinase-like orphan receptor 1
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCED
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 4919

Enviar un mensaje


ROR1 (Human) Recombinant Protein

ROR1 (Human) Recombinant Protein