ROR1 (Human) Recombinant Protein View larger

Human ROR1 (Q01973) recombinant protein expressed in CHO cells.

AB-P6400

New product

ROR1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name ROR1
Gene Alias MGC99659|NTRKR1|dJ537F10.1
Gene Description receptor tyrosine kinase-like orphan receptor 1
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCED
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 4919

More info

Human ROR1 (Q01973) recombinant protein expressed in CHO cells.

Enviar uma mensagem

Human ROR1 (Q01973) recombinant protein expressed in CHO cells.

Human ROR1 (Q01973) recombinant protein expressed in CHO cells.