NOV (Human) Recombinant Protein
  • NOV (Human) Recombinant Protein

NOV (Human) Recombinant Protein

Ref: AB-P6380
NOV (Human) Recombinant Protein

Información del producto

Human NOV (P48745) recombinant protein expressed in E. Coli.
Información adicional
Size 20 ug
Gene Name NOV
Gene Alias CCN3|IGFBP9
Gene Description nephroblastoma overexpressed gene
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNC
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 4856

Enviar un mensaje


NOV (Human) Recombinant Protein

NOV (Human) Recombinant Protein