Ver mas grande
NOV (Human) Recombinant Protein
AB-P6380
Producto nuevo
NOV (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | NOV |
| Gene Alias | CCN3|IGFBP9 |
| Gene Description | nephroblastoma overexpressed gene |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNC |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 4856 |
Más información
Human NOV (P48745) recombinant protein expressed in E. Coli.