NOV (Human) Recombinant Protein View larger

Human NOV (P48745) recombinant protein expressed in <i>E. Coli</i>.

AB-P6380

New product

NOV (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name NOV
Gene Alias CCN3|IGFBP9
Gene Description nephroblastoma overexpressed gene
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNC
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 4856

More info

Human NOV (P48745) recombinant protein expressed in E. Coli.

Enviar uma mensagem

Human NOV (P48745) recombinant protein expressed in <i>E. Coli</i>.

Human NOV (P48745) recombinant protein expressed in <i>E. Coli</i>.