NRN1 (Human) Recombinant Protein
  • NRN1 (Human) Recombinant Protein

NRN1 (Human) Recombinant Protein

Ref: AB-P6366
NRN1 (Human) Recombinant Protein

Información del producto

Human NRN1 (Q9NPD7) recombinant protein expressed in E. Coli.
Información adicional
Size 100 ug
Gene Name NRN1
Gene Alias MGC44811|NRN|dJ380B8.2
Gene Description neuritin 1
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 51299

Enviar un mensaje


NRN1 (Human) Recombinant Protein

NRN1 (Human) Recombinant Protein