View larger
Human NRN1 (Q9NPD7) recombinant protein expressed in <i>E. Coli</i>.
AB-P6366
New product
NRN1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | NRN1 |
| Gene Alias | MGC44811|NRN|dJ380B8.2 |
| Gene Description | neuritin 1 |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 51299 |
More info
Human NRN1 (Q9NPD7) recombinant protein expressed in E. Coli.