GDF3 (Human) Recombinant Protein
  • GDF3 (Human) Recombinant Protein

GDF3 (Human) Recombinant Protein

Ref: AB-P6359
GDF3 (Human) Recombinant Protein

Información del producto

Human GDF3 (Q9UK05) recombinant protein expressed in E. Coli.
Información adicional
Size 100 ug
Gene Name GDF3
Gene Alias -
Gene Description growth differentiation factor 3
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 9573

Enviar un mensaje


GDF3 (Human) Recombinant Protein

GDF3 (Human) Recombinant Protein