GDF3 (Human) Recombinant Protein View larger

Human GDF3 (Q9UK05) recombinant protein expressed in <i>E. Coli</i>.

AB-P6359

New product

GDF3 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.


Data sheet

Size 100 ug
Gene Name GDF3
Gene Alias -
Gene Description growth differentiation factor 3
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 9573

More info

Human GDF3 (Q9UK05) recombinant protein expressed in E. Coli.

Enviar uma mensagem

Human GDF3 (Q9UK05) recombinant protein expressed in <i>E. Coli</i>.

Human GDF3 (Q9UK05) recombinant protein expressed in <i>E. Coli</i>.