Ver mas grande
FGF19 (Human) Recombinant Protein
AB-P6352
Producto nuevo
FGF19 (Human) Recombinant Protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FGF19 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 19 |
| Storage Conditions | Stored lyophilized product at -20ºC.<br>After reconstitution with distilled water to a concentration not less than 0.1 mg/mL, store at -20ºC for 12 months or store at 2-8ºC for 3 weeks.<br>Aliquot to avoid repeated freezing and thawing.<br>Centrifuge vial |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from 0.2 um filtered 50 mM Tris, pH 8. |
| Gene ID | 9965 |
Más información
Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in E. Coli.