FGF19 (Human) Recombinant Protein
  • FGF19 (Human) Recombinant Protein

FGF19 (Human) Recombinant Protein

Ref: AB-P6352
FGF19 (Human) Recombinant Protein

Información del producto

Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in E. Coli.
Información adicional
Size 100 ug
Gene Name FGF19
Gene Alias -
Gene Description fibroblast growth factor 19
Storage Conditions Stored lyophilized product at -20C.
After reconstitution with distilled water to a concentration not less than 0.1 mg/mL, store at -20C for 12 months or store at 2-8C for 3 weeks.
Aliquot to avoid repeated freezing and thawing.
Centrifuge vial to
Application Key WB,Func
Immunogen Prot. Seq MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form Lyophilized
Storage Buffer Lyophilized from 0.2 um filtered 50 mM Tris, pH 8.
Gene ID 9965

Enviar uma mensagem


FGF19 (Human) Recombinant Protein

FGF19 (Human) Recombinant Protein