FGF19 (Human) Recombinant Protein View larger

Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in <i>E. Coli</i>.

AB-P6352

New product

FGF19 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.


Data sheet

Size 100 ug
Gene Name FGF19
Gene Alias -
Gene Description fibroblast growth factor 19
Storage Conditions Stored lyophilized product at -20ºC.<br>After reconstitution with distilled water to a concentration not less than 0.1 mg/mL, store at -20ºC for 12 months or store at 2-8ºC for 3 weeks.<br>Aliquot to avoid repeated freezing and thawing.<br>Centrifuge vial
Application Key WB,Func
Immunogen Prot. Seq MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form Lyophilized
Storage Buffer Lyophilized from 0.2 um filtered 50 mM Tris, pH 8.
Gene ID 9965

More info

Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in E. Coli.

Enviar uma mensagem

Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in <i>E. Coli</i>.

Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in <i>E. Coli</i>.