Ver mas grande
FGF18 (Human) Recombinant Protein
AB-P6351
Producto nuevo
FGF18 (Human) Recombinant Protein
Comprando este producto generará 19 Biopuntos. Su cesta contiene un total 19 Biopuntos puede ser convertido en un Biobonos Descuento 76.00EUR.
Hoja técnica
| Size | 250 ug |
| Gene Name | FGF18 |
| Gene Alias | FGF-18|ZFGF5 |
| Gene Description | fibroblast growth factor 18 |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB |
| Immunogen Prot. Seq | AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 8817 |
Más información
Human FGF18 (O76093) recombinant protein expressed in E. Coli.