View larger
Human FGF18 (O76093) recombinant protein expressed in <i>E. Coli</i>.
AB-P6351
New product
FGF18 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 19 pontos de fidelização. Seu carrinho totalizará 19 pontos de fidelização que podem ser convertidos num vale de desconto de 76.00EUR.
Data sheet
| Size | 250 ug |
| Gene Name | FGF18 |
| Gene Alias | FGF-18|ZFGF5 |
| Gene Description | fibroblast growth factor 18 |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB |
| Immunogen Prot. Seq | AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 8817 |
More info
Human FGF18 (O76093) recombinant protein expressed in E. Coli.