Ccl6 (Mouse) Recombinant Protein
  • Ccl6 (Mouse) Recombinant Protein

Ccl6 (Mouse) Recombinant Protein

Ref: AB-P6338
Ccl6 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl6 (P27784) recombinant protein expressed in E. Coli.
Información adicional
Size 10 ug
Gene Name Ccl6
Gene Alias MRP-1|Scya6|c10
Gene Description chemokine (C-C motif) ligand 6
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA_x005F_x005F_x005F_x000D__x005F_x000D__x000D_
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 20305

Enviar un mensaje


Ccl6 (Mouse) Recombinant Protein

Ccl6 (Mouse) Recombinant Protein