AB-P6338
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 10 ug |
Gene Name | Ccl6 |
Gene Alias | MRP-1|Scya6|c10 |
Gene Description | chemokine (C-C motif) ligand 6 |
Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB,Func |
Immunogen Prot. Seq | GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA_x005F_x005F_x005F_x000D__x005F_x000D__x000D_ |
Form | Lyophilized |
Storage Buffer | Lyophilized from PBS, pH 7.2. |
Gene ID | 20305 |