Ver mas grande
ANGPTL3 (Human) Recombinant Protein
AB-P6327
Producto nuevo
ANGPTL3 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | ANGPTL3 |
| Gene Alias | ANGPT5 |
| Gene Description | angiopoietin-like 3 |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 27329 |
Más información
Human ANGPTL3 (Q9Y5C1) recombinant protein expressed in CHO cells.