ANGPTL3 (Human) Recombinant Protein View larger

Human ANGPTL3 (Q9Y5C1) recombinant protein expressed in CHO cells.

AB-P6327

New product

ANGPTL3 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 27329

More info

Human ANGPTL3 (Q9Y5C1) recombinant protein expressed in CHO cells.

Enviar uma mensagem

Human ANGPTL3 (Q9Y5C1) recombinant protein expressed in CHO cells.

Human ANGPTL3 (Q9Y5C1) recombinant protein expressed in CHO cells.