ANGPTL3 (Human) Recombinant Protein
  • ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein

Ref: AB-P6327
ANGPTL3 (Human) Recombinant Protein

Información del producto

Human ANGPTL3 (Q9Y5C1) recombinant protein expressed in CHO cells.
Información adicional
Size 50 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Stored at -20C to-80C.
After reconstitution with sterile water not less than 0.1 mg/mL, store at -20C to -80C for 6 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 27329

Enviar uma mensagem


ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein