IHH (Human/Mouse) Recombinant Protein
  • IHH (Human/Mouse) Recombinant Protein

IHH (Human/Mouse) Recombinant Protein

Ref: AB-P6321
IHH (Human/Mouse) Recombinant Protein

Información del producto

Human/Mouse IHH (Q14623/P97812) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name IHH
Gene Alias BDA1|HHG2
Gene Description Indian hedgehog homolog (Drosophila)
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with 10 mM HCl at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MIIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 3549|16147

Enviar un mensaje


IHH (Human/Mouse) Recombinant Protein

IHH (Human/Mouse) Recombinant Protein