View larger
Human/Mouse IHH (Q14623/P97812) recombinant protein expressed in <i>E.Coli</i>.
AB-P6321
New product
IHH (Human/Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | IHH |
| Gene Alias | BDA1|HHG2 |
| Gene Description | Indian hedgehog homolog (Drosophila) |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with 10 mM HCl at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MIIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Gene ID | 3549|16147 |
More info
Human/Mouse IHH (Q14623/P97812) recombinant protein expressed in E.Coli.