Ver mas grande
Gdnf (Mouse) Recombinant Protein
AB-P6273
Producto nuevo
Gdnf (Mouse) Recombinant Protein
Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Gdnf |
| Gene Alias | AI385739 |
| Gene Description | glial cell line derived neurotrophic factor |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MSPDKQAALPRRENRNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Gene ID | 14573 |
Más información
Mouse Gdnf (P48540) recombinant protein expressed in E.Coli.