Gdnf (Mouse) Recombinant Protein
  • Gdnf (Mouse) Recombinant Protein

Gdnf (Mouse) Recombinant Protein

Ref: AB-P6273
Gdnf (Mouse) Recombinant Protein

Información del producto

Mouse Gdnf (P48540) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name Gdnf
Gene Alias AI385739
Gene Description glial cell line derived neurotrophic factor
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MSPDKQAALPRRENRNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 14573

Enviar uma mensagem


Gdnf (Mouse) Recombinant Protein

Gdnf (Mouse) Recombinant Protein