FGF9 (Human) Recombinant Protein
  • FGF9 (Human) Recombinant Protein

FGF9 (Human) Recombinant Protein

Ref: AB-P6243
FGF9 (Human) Recombinant Protein

Información del producto

Human FGF9 (P31371) recombinant protein expressed in E.Coli.
Información adicional
Size 100 ug
Gene Name FGF9
Gene Alias GAF|HBFG-9|MGC119914|MGC119915
Gene Description fibroblast growth factor 9 (glia-activating factor)
Storage Conditions Stored at -20C to-80C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20C to -80C for 3 months, store at 4C for 1 month.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 25 mM NaCl, 50 mM sodium sulfate, pH 7.5.
Gene ID 2254

Enviar un mensaje


FGF9 (Human) Recombinant Protein

FGF9 (Human) Recombinant Protein