View larger
Human FGF9 (P31371) recombinant protein expressed in <i>E.Coli</i>.
AB-P6243
New product
FGF9 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 11 pontos de fidelização. Seu carrinho totalizará 11 pontos de fidelização que podem ser convertidos num vale de desconto de 44.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | FGF9 |
| Gene Alias | GAF|HBFG-9|MGC119914|MGC119915 |
| Gene Description | fibroblast growth factor 9 (glia-activating factor) |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 25 mM NaCl, 50 mM sodium sulfate, pH 7.5. |
| Gene ID | 2254 |
More info
Human FGF9 (P31371) recombinant protein expressed in E.Coli.