Ver mas grande
FGF5 (Human) Recombinant Protein
AB-P6231
Producto nuevo
FGF5 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FGF5 |
| Gene Alias | HBGF-5|Smag-82 |
| Gene Description | fibroblast growth factor 5 |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.<br>If a precipitate is observed, centrifuge t |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate and 100 mM sodium chloride, pH 7.5. |
| Gene ID | 2250 |
Más información
Human FGF5 (P12034) recombinant protein expressed in E.Coli.