FGF5 (Human) Recombinant Protein View larger

Human FGF5 (P12034) recombinant protein expressed in <i>E.Coli</i>.

AB-P6231

New product

FGF5 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 ug
Gene Name FGF5
Gene Alias HBGF-5|Smag-82
Gene Description fibroblast growth factor 5
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.<br>If a precipitate is observed, centrifuge t
Application Key WB,Func
Immunogen Prot. Seq MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate and 100 mM sodium chloride, pH 7.5.
Gene ID 2250

More info

Human FGF5 (P12034) recombinant protein expressed in E.Coli.

Enviar uma mensagem

Human FGF5 (P12034) recombinant protein expressed in <i>E.Coli</i>.

Human FGF5 (P12034) recombinant protein expressed in <i>E.Coli</i>.