CXCL5 (Human) Recombinant Protein Ver mas grande

CXCL5 (Human) Recombinant Protein

AB-P6222

Producto nuevo

CXCL5 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 ug
Gene Name CXCL5
Gene Alias ENA-78|SCYB5
Gene Description chemokine (C-X-C motif) ligand 5
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 6374

Más información

Human CXCL5 (P42830) recombinant protein expressed in E.Coli.

Consulta sobre un producto

CXCL5 (Human) Recombinant Protein

CXCL5 (Human) Recombinant Protein