AB-P6222
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Size | 100 ug |
Gene Name | CXCL5 |
Gene Alias | ENA-78|SCYB5 |
Gene Description | chemokine (C-X-C motif) ligand 5 |
Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB |
Immunogen Prot. Seq | AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Form | Lyophilized |
Quality control testing | Reducing and Non-Reducing SDS PAGE |
Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
Gene ID | 6374 |