AB-P6219
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Size | 100 ug |
Gene Name | PDGFB |
Gene Alias | FLJ12858|PDGF2|SIS|SSV|c-sis |
Gene Description | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB,Func |
Immunogen Prot. Seq | MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Form | Lyophilized |
Quality control testing | Reducing and Non-Reducing SDS PAGE |
Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5. |
Gene ID | 5155 |