View larger
Human PDGFB (P01127) recombinant protein expressed in <i>E.Coli</i>.
AB-P6219
New product
PDGFB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PDGFB |
| Gene Alias | FLJ12858|PDGF2|SIS|SSV|c-sis |
| Gene Description | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5. |
| Gene ID | 5155 |
More info
Human PDGFB (P01127) recombinant protein expressed in E.Coli.