GH1 (Human) Recombinant Protein
  • GH1 (Human) Recombinant Protein

GH1 (Human) Recombinant Protein

Ref: AB-P5906
GH1 (Human) Recombinant Protein

Información del producto

Human GH1 (NP_000506, 1 a.a. - 217 a.a.) full-length recombinant protein with C-terminal hexahistidine tag expressed HEK293EBNA1 cells.
Información adicional
Size 1 mg
Gene Name GH1
Gene Alias GH|GH-N|GHN|hGH-N
Gene Description growth hormone 1
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFGSAAAHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer In PBS without preservative
Gene ID 2688

Enviar un mensaje


GH1 (Human) Recombinant Protein

GH1 (Human) Recombinant Protein