View larger
Human GH1 (NP_000506, 1 a.a. - 217 a.a.) full-length recombinant protein with C-terminal hexahistidine tag expressed HEK293EBNA1
AB-P5906
New product
GH1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 9 pontos de fidelização. Seu carrinho totalizará 9 pontos de fidelização que podem ser convertidos num vale de desconto de 36.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | GH1 |
| Gene Alias | GH|GH-N|GHN|hGH-N |
| Gene Description | growth hormone 1 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFGSAAAHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In PBS without preservative |
| Gene ID | 2688 |
More info
Human GH1 (NP_000506, 1 a.a. - 217 a.a.) full-length recombinant protein with C-terminal hexahistidine tag expressed HEK293EBNA1 cells.