Ver mas grande
XAGE1C (Human) Recombinant Protein
AB-P5873
Producto nuevo
XAGE1C (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | XAGE1C |
| Gene Alias | - |
| Gene Description | X antigen family, member 1C |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 7.5 (2 mM DTT, 30% glycerol, 0.1 mM PMSF). |
| Gene ID | 653048 |
Más información
Human XAGE1C (NP_001091061, 1 a.a. - 81 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.