XAGE1C (Human) Recombinant Protein View larger

Human XAGE1C (NP_001091061, 1 a.a. - 81 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P5873

New product

XAGE1C (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name XAGE1C
Gene Alias -
Gene Description X antigen family, member 1C
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, pH 7.5 (2 mM DTT, 30% glycerol, 0.1 mM PMSF).
Gene ID 653048

More info

Human XAGE1C (NP_001091061, 1 a.a. - 81 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human XAGE1C (NP_001091061, 1 a.a. - 81 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human XAGE1C (NP_001091061, 1 a.a. - 81 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.